Топ питань
Часова шкала
Чат
Перспективи

Аполіпопротеїн D

білок-кодуючий ген Homo Sapiens З Вікіпедії, вільної енциклопедії

Аполіпопротеїн D
Remove ads

Аполіпротеїн D (англ. Apolipoprotein D) – білок, який кодується геном APOD, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 189 амінокислот, а молекулярна маса — 21 276[4].

Послідовність амінокислот
1020304050
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIE
KIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLT
EPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILA
RNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS
Коротка інформація Наявні структури, PDB ...

Задіяний у такому біологічному процесі як транспорт. Білок має сайт для зв'язування з ліпідами. Секретований назовні.

Remove ads

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Holzfeind P., Merschak P., Dieplinger H., Redl B. (1995). The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA, both species encoding members of the lipocalin superfamily. Exp. Eye Res. 61: 495—500. PMID 8549691 doi:10.1016/S0014-4835(05)80145-9
  • Balbin M., Freije J.M.P., Fueyo A., Sanchez L.M., Lopez-Otin C. (1990). Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease. Biochem. J. 271: 803—807. PMID 2244881 doi:10.1042/bj2710803
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 4: 454—465. PMID 14760718 doi:10.1002/pmic.200300556
  • Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. (2011). Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD. Mol. Cell. Proteomics: —. PMID 22171320 doi:10.1074/mcp.M111.013649
  • Schindler P.A., Settineri C.A., Collet X., Fielding C.J., Burlingame A.L. (1995). Site-specific detection and structural characterization of the glycosylation of human plasma proteins lecithin:cholesterol acyltransferase and apolipoprotein D using HPLC/electrospray mass spectrometry and sequential glycosidase digestion. Protein Sci. 4: 791—803. PMID 7613477 doi:10.1002/pro.5560040419
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads