Топ питань
Часова шкала
Чат
Перспективи

Гліальний фібрилярний кислий білок

білок людини З Вікіпедії, вільної енциклопедії

Гліальний фібрилярний кислий білок
Remove ads

GFAP (англ. Glial fibrillary acidic protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 49 880[5].

Послідовність амінокислот
1020304050
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV
DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE
LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT
VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL
RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM
HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS
EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Коротка інформація GFAP, Наявні структури ...

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі, проміжних філаментах.

Remove ads

Література

  • Reeves S.A., Helman L.J., Allison A., Israel M.A. (1989). Molecular cloning and primary structure of human glial fibrillary acidic protein. Proc. Natl. Acad. Sci. U.S.A. 86: 5178—5182. PMID 2740350 doi:10.1073/pnas.86.13.5178
  • Isaacs A., Baker M., Wavrant-De Vrieze F., Hutton M. (1998). Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17. Genomics. 51: 152—154. PMID 9693047 doi:10.1006/geno.1998.5360
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Nakatani Y., Brenner M., Freese E. (1990). An RNA polymerase II promoter containing sequences upstream and downstream from the RNA startpoint that direct initiation of transcription from the same site. Proc. Natl. Acad. Sci. U.S.A. 87: 4289—4293. PMID 2349237 doi:10.1073/pnas.87.11.4289
  • Duguid J.R., Bohmont C.W., Liu N.G., Tourtellotte W.W. (1989). Changes in brain gene expression shared by scrapie and Alzheimer disease. Proc. Natl. Acad. Sci. U.S.A. 86: 7260—7264. PMID 2780570 doi:10.1073/pnas.86.18.7260
  • Singh R., Nielsen A.L., Johansen M.G., Jorgensen A.L. (2003). Genetic polymorphism and sequence evolution of an alternatively spliced exon of the glial fibrillary acidic protein gene, GFAP. Genomics. 82: 185—193. PMID 12837269 doi:10.1016/S0888-7543(03)00106-X
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads