Топ питань
Часова шкала
Чат
Перспективи

Аквапорин-1

білок-кодуючий ген Homo Sapiens З Вікіпедії, вільної енциклопедії

Аквапорин-1
Remove ads

Аквапорин-1, AQP1 (англ. Aquaporin 1 (Colton blood group)) – білок, який кодується геном AQP1, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 28 526[5].

Послідовність амінокислот
1020304050
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNV
KVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIA
QCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLV
LCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSA
VITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQV
EEYDLDADDINSRVEMKPK
Коротка інформація AQP1, Наявні структури ...

Кодований геном білок за функцією належить до аквапоринів - трансмембранних білків, які є каналами для молекул води. Належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані.

Remove ads

Література

  • Preston G.M., Agre P. (1991). Isolation of the cDNA for erythrocyte integral membrane protein of 28 kilodaltons: member of an ancient channel family. Proc. Natl. Acad. Sci. U.S.A. 88: 11110—11114. PMID 1722319 doi:10.1073/pnas.88.24.11110
  • Ruiz A.C., Bok D. (1996). Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium. Biochim. Biophys. Acta. 1282: 174—178. PMID 8703970 doi:10.1016/0005-2736(96)00076-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Preston G.M., Carroll T.P., Guggino W.B., Agre P. (1992). Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein. Science. 256: 385—387. PMID 1373524 doi:10.1126/science.256.5055.385
  • Rungaldier S., Oberwagner W., Salzer U., Csaszar E., Prohaska R. (2013). Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains. Biochim. Biophys. Acta. 1828: 956—966. PMID 23219802 doi:10.1016/j.bbamem.2012.11.030
  • de Groot B.L., Engel A., Grubmueller H. (2001). A refined structure of human aquaporin-1. FEBS Lett. 504: 206—211. PMID 11532455 doi:10.1016/S0014-5793(01)02743-0
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads