Top Qs
Timeline
Chat
Perspective

Ssm spooky toxin

Centipede toxin From Wikipedia, the free encyclopedia

Ssm spooky toxin
Remove ads

Spooky toxin (SsTx) is a small peptide neurotoxin. It is found in the venom of Chinese red-headed centipedes (Scolopendra subspinipes mutilans), also known as golden head centipedes. It is originally composed of 76 amino acids (sequence: MEKKIIFLVFLVAL LALPGFISTEVIKK DTPYKKRKFPYKSEC LKACATSFTG GDESRIQEGKPG FFKCTCYFTTG, disulfide bonds Cys43-Cys69, Cys47-Cys71), with a molecular weight of 6017.5 daltons, but loses the first 23 residues and becomes 53 residues long (sequence EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPFGFKCTCYFTTG, disulfide bonds Cys20-Cys46, Cys24-Cys48). SsTx is currently thought to be unique to Scolopendra subspinipes mutilans.

Quick Facts Spooky toxin, Identifiers ...

By blocking KCNQ channels (preventing potassium from flowing into and out of cells) SsTx disrupts cardiovascular, respiratory, muscular, and nervous systems; where snake venoms typically only affect circulatory or nervous systems, and venom from spiders, scorpions, and snails typically only target nervous systems. This allows for golden headed centipedes to target larger prey up to 15 times their size.[1]

Remove ads

Applications

The venom of the Scolopendra subspinipes mutilans is already being widely used as a traditional medicine in Asian countries.[2] Claimed medicinal uses include antimicrobial, antibacterial, and anticancer.[3][4][5]

See also

References

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads