Топ питань
Часова шкала
Чат
Перспективи

CSF2

білок людини З Вікіпедії, вільної енциклопедії

CSF2
Remove ads

CSF2 (англ. Colony stimulating factor 2) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 144 амінокислот, а молекулярна маса — 16 295[4].

Послідовність амінокислот
1020304050
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTA
AEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASH
YKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Коротка інформація Наявні структури, PDB ...

Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у такому біологічному процесі, як поліморфізм. Секретований назовні.

Remove ads

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Kaushansky K., Lopez J.A., Brown C.B. (1992). Role of carbohydrate modification in the production and secretion of human granulocyte macrophage colony-stimulating factor in genetically engineered and normal mesenchymal cells. Biochemistry. 31: 1881—1886. PMID 1737041 doi:10.1021/bi00121a042
  • Diederichs K., Boone T., Karplus P.A. (1991). Novel fold and putative receptor binding site of granulocyte-macrophage colony-stimulating factor. Science. 254: 1779—1782. PMID 1837174 doi:10.1126/science.1837174
  • Miyatake S., Otsuka T., Yokota T., Lee F., Arai K. (1985). Structure of the chromosomal gene for granulocyte-macrophage colony stimulating factor: comparison of the mouse and human genes. EMBO J. 4: 2561—2568. PMID 3876930
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads