Топ питань
Часова шкала
Чат
Перспективи

GSTM1

білок-кодуючий ген Homo Sapiens З Вікіпедії, вільної енциклопедії

GSTM1
Remove ads

GSTM1 (англ. Glutathione S-transferase mu 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 25 712[4].

Послідовність амінокислот
1020304050
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK
FKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL
ENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAG
NKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKS
SRFLPRPVFSKMAVWGNK
Коротка інформація Наявні структури, PDB ...

Кодований геном білок за функціями належить до трансфераз, фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у цитоплазмі.

Remove ads

Література

  • Dejong J.L., Chang C.M., Whang Peng J., Knutsen T., Tu C.-P.D. (1988). The human liver glutathione S-transferase gene superfamily: expression and chromosome mapping of an Hb subunit cDNA. Nucleic Acids Res. 16: 8541—8554. PMID 3419925 doi:10.1093/nar/16.17.8541
  • Seidegaard J., Vorachek W.R., Pero R.W., Pearson W.R. (1988). Hereditary differences in the expression of the human glutathione transferase active on trans-stilbene oxide are due to a gene deletion. Proc. Natl. Acad. Sci. U.S.A. 85: 7293—7297. PMID 3174634 doi:10.1073/pnas.85.19.7293
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Zhong S., Spurr N.K., Hayes J.D., Wolf C.R. (1993). Deduced amino acid sequence, gene structure and chromosomal location of a novel human class Mu glutathione S-transferase, GSTM4. Biochem. J. 291: 41—50. PMID 8471052 doi:10.1042/bj2910041
  • Alin P., Mannervik B., Joernvall H. (1985). Structural evidence for three different types of glutathione transferase in human tissues. FEBS Lett. 182: 319—322. PMID 3979555 doi:10.1016/0014-5793(85)80324-0
  • Hubbard M.J., McHugh N.J. (2000). Human ERp29: isolation, primary structural characterisation and two-dimensional gel mapping. Electrophoresis. 21: 3785—3796. PMID 11271497 doi:10.1002/1522-2683(200011)21:17<3785::AID-ELPS3785>3.0.CO;2-2
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads