Топ питань
Часова шкала
Чат
Перспективи

TIMP2

білок-кодуючий ген Homo Sapiens З Вікіпедії, вільної енциклопедії

TIMP2
Remove ads

TIMP2 (англ. TIMP metallopeptidase inhibitor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 24 399[5].

Послідовність амінокислот
1020304050
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAV
SEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGV
SLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQM
GCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
CAWYRGAAPPKQEFLDIEDP
Коротка інформація Наявні структури, PDB ...

Кодований геном білок за функціями належить до інгібіторів протеаз, інгібіторів металоферментів. Білок має сайт для зв'язування з іонами металів, іоном цинку. Секретований назовні.

Remove ads

Література

  • Boone T.C., Johnson M.J., de Clerck Y.A., Langley K.E. (1990). cDNA cloning and expression of a metalloproteinase inhibitor related to tissue inhibitor of metalloproteinases. Proc. Natl. Acad. Sci. U.S.A. 87: 2800—2804. PMID 2157214 doi:10.1073/pnas.87.7.2800
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Osthues A., Knaueper V., Oberhoff R., Reinke H., Tschesche H. (1992). Isolation and characterization of tissue inhibitors of metalloproteinases (TIMP-1 and TIMP-2) from human rheumatoid synovial fluid. FEBS Lett. 296: 16—20. PMID 1730286 doi:10.1016/0014-5793(92)80393-U
  • de Clerck Y.A., Darville M.I., Eeckhout Y., Rousseau G.G. (1994). Characterization of the promoter of the gene encoding human tissue inhibitor of metalloproteinases-2 (TIMP-2). Gene. 139: 185—191. PMID 8112602 doi:10.1016/0378-1119(94)90753-6
  • Chattopadhyay N., Mitra A., Frei E., Chatterjee A. (2001). Human cervical tumor cell (SiHa) surface alphavbeta3 integrin receptor has associated matrix metalloproteinase (MMP-2) activity. J. Cancer Res. Clin. Oncol. 127: 653—658. PMID 11710594 doi:10.1007/s004320100271
  • Morgunova E., Tuuttila A., Bergmann U., Tryggvason K. (2002). Structural insight into the complex formation of latent matrix metalloproteinase 2 with tissue inhibitor of metalloproteinase 2. Proc. Natl. Acad. Sci. U.S.A. 99: 7414—7419. PMID 12032297 doi:10.1073/pnas.102185399
Remove ads

Примітки

Див. також

Loading related searches...

Wikiwand - on

Seamless Wikipedia browsing. On steroids.

Remove ads